DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and dbx1b

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_571253.1 Gene:dbx1b / 30416 ZFINID:ZDB-GENE-000128-11 Length:322 Species:Danio rerio


Alignment Length:331 Identity:98/331 - (29%)
Similarity:139/331 - (41%) Gaps:83/331 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 LDKLFPGPYMDYKSVLRPTPI----RAAEHAAPTYPTLATNALLRFHQHQKQQHQQHHHHQHHPK 207
            |..:...|.| |.|.|||:..    .|.:.|..|:.:.....|||..:.....|:.      .|.
Zfish     3 LPSVIAPPAM-YPSFLRPSSALSLPPALQSAFTTHSSFLVEDLLRISRPAAFMHRS------IPS 60

  Fly   208 HLHQQHKPPPHNSTTASALLAPLHSLTSLQLTQQQQRFLGKTPQQLLDIAPT----SPAAAAAAT 268
               ....||....||.:...:.:|...|..|.::     ..:||..:...|.    ...|..|:|
Zfish    61 ---PSASPPATGVTTLNTTSSAVHVAMSTALAKR-----SSSPQTSISSDPNYLKFGVNAILAST 117

  Fly   269 SQNGAHGH--GGGNGQ---------------------GNASA-----------GSNGKRKRSW-S 298
            ::|.:...  .|.|.:                     .::||           .:.||.:|.. .
Zfish   118 TRNASPPPPVQGMNAKTFPFPCFDGSFHPFIRASYFPASSSAVPIPGTFAWPLTARGKPRRGMLR 182

  Fly   299 RAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKWRHT--RENLKSG- 360
            |||||::|||.||..||:||||:||||:|||.:|.|.|:|||:||||||||||::  ||.|.|| 
Zfish   183 RAVFSDVQRKALEKMFQKQKYISKPDRKKLATKLGLKDSQVKIWFQNRRMKWRNSKERELLSSGG 247

  Fly   361 --QEKQPSAV---PESGGVFK--------TSTP-------SGDGTPQEALDYSSDSCSS--VDLS 403
              ::..|:.:   |:...|.|        ..:|       .||......|.:.|.|.||  .|.|
Zfish   248 CREQTLPTKMNPNPDLSDVGKRFEHEAVLRESPRAPFCQSRGDHEFNADLHFKSPSISSKHSDFS 312

  Fly   404 EQADED 409
            |..||:
Zfish   313 ESEDEE 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 37/52 (71%)
dbx1bNP_571253.1 COG5576 <173..296 CDD:227863 54/122 (44%)
Homeobox 182..235 CDD:278475 37/52 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 238..266 7/27 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 296..322 10/23 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.