DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and Dlx4

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001100510.1 Gene:Dlx4 / 303469 RGDID:1308744 Length:238 Species:Rattus norvegicus


Alignment Length:257 Identity:61/257 - (23%)
Similarity:89/257 - (34%) Gaps:94/257 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 GHATLPP-TFTPTSSHTYPFVGLDKLFPGPYMDYKSVLRPTPIRAAEHAAPTYPTLATNALLRFH 189
            |.|..|. :|:.|..|.     |...:|||.....|.|.    ...:.|||:.|         ||
  Rat    38 GTAASPDLSFSQTYGHL-----LSYSYPGPATPGDSYLS----SQQQSAAPSRP---------FH 84

  Fly   190 QHQKQQHQQHHHHQHHPKHLHQQHKPPPHNSTTASALLAPLHSLTSLQLTQQQQRFLGKTPQQLL 254
            |..:           ||:.|..:           |..||                         |
  Rat    85 QPTE-----------HPQELEAE-----------SEKLA-------------------------L 102

  Fly   255 DIAPTSPAAAAAATSQNGAHGHGGGNGQGNASAGSNGKRKRSWSRAVFSNLQRKGLEIQFQQQKY 319
            .:.|:.|:..                            ||....|.::|:||.:.|..:||..:|
  Rat   103 SLEPSQPSLT----------------------------RKLRKPRTIYSSLQLQHLNQRFQHTQY 139

  Fly   320 ITKPDRRKLAARLNLTDAQVKVWFQNRRMKWRHTRENLKSGQEKQPSAVPESGGVFKTSTPS 381
            :..|:|.:|||:|.||..|||:||||:|.|::...:......|:..|..|.|......:.||
  Rat   140 LALPERAQLAAQLGLTQTQVKIWFQNKRSKYKKLLKQSSGELEEDFSGRPPSLSPHSLTLPS 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 25/52 (48%)
Dlx4NP_001100510.1 Homeobox 118..172 CDD:395001 25/53 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.