DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and TLX3

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_066305.2 Gene:TLX3 / 30012 HGNCID:13532 Length:291 Species:Homo sapiens


Alignment Length:335 Identity:81/335 - (24%)
Similarity:115/335 - (34%) Gaps:128/335 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 SPTSA-TSTTKVKLSFSVDRLLGSEPEESHRQSSSSPSTKSCCDGSILACCSFPHCFSQANAESR 123
            :|.|| |......:||.:|::|.| |::....:...|...|...|                    
Human     3 APASAQTPHPHEPISFGIDQILNS-PDQDSAPAPRGPDGASYLGG-------------------- 46

  Fly   124 RFGHATLPPTFTPTSSHTYP-----FVGLDKLFPGPYMDYKS-----------VLR--------- 163
                   ||...|.:  |||     |.||.    .|:.|..|           |:|         
Human    47 -------PPGGRPGA--TYPSLPASFAGLG----APFEDAGSYSVNLSLAPAGVIRVPAHRPLPG 98

  Fly   164 --PTPIRAAEHAAPTYPTLATNALLRFHQHQKQQHQQHHHHQHHPKHLHQQHKPPPHNSTTASAL 226
              |.|:.:|..|.|:.||:::...|.|...:..:..                   ..:..||:|.
Human    99 AVPPPLPSALPAMPSVPTVSSLGGLNFPWMESSRRF-------------------VKDRFTAAAA 144

  Fly   227 LAPLHSLTSLQLTQQQQRFLGKTPQQLLDIAPTSPAAAAAATSQNGAHGHGGGNGQGNASAGSNG 291
            |.|. ::|         |.:|...|.     .|.|                              
Human   145 LTPF-TVT---------RRIGHPYQN-----RTPP------------------------------ 164

  Fly   292 KRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKWRHTREN 356
            |||:  .|..||.:|...||.:|.:|||:...:|..||..|.:||||||.||||||.|||.....
Human   165 KRKK--PRTSFSRVQICELEKRFHRQKYLASAERAALAKSLKMTDAQVKTWFQNRRTKWRRQTAE 227

  Fly   357 LKSGQEKQPS 366
            .:..:.:|.|
Human   228 EREAERQQAS 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 27/52 (52%)
TLX3NP_066305.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..56 16/82 (20%)
Homeobox 169..223 CDD:395001 28/53 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.