DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and Pdx1

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_074043.4 Gene:Pdx1 / 29535 RGDID:62387 Length:283 Species:Rattus norvegicus


Alignment Length:233 Identity:62/233 - (26%)
Similarity:87/233 - (37%) Gaps:60/233 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 HHHQHHPKHLHQQHKPP---PHNSTTASALLAPLHSLTSLQLTQQQQRFLGKTPQQLLDIAPTSP 261
            |.|.|.|..|...|.||   |:.:.|...                      :.|.::....|...
  Rat    81 HLHHHLPAQLGLAHPPPGPFPNGTETGGL----------------------EEPSRVHLPFPWMK 123

  Fly   262 AAAAAATSQNGAHGHGGGNGQGNASAGSNGKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRR 326
            :..|.|.....|         |.|.|....:.||  :|..::..|...||.:|...|||::|.|.
  Rat   124 STKAHAWKSQWA---------GGAYAAEPEENKR--TRTAYTRAQLLELEKEFLFNKYISRPRRV 177

  Fly   327 KLAARLNLTDAQVKVWFQNRRMKWRHTRENLKS---------GQE-KQPSAV------------P 369
            :||..||||:..:|:|||||||||:...:..:|         |:| :|..||            |
  Rat   178 ELAVMLNLTERHIKIWFQNRRMKWKKEEDKKRSSGTTSGGGGGEEPEQDCAVTSGEELLALPPPP 242

  Fly   370 ESGGVFKTSTPSG--DGTPQEALDYSSDSCSSVDLSEQ 405
            ..||...:..|:.  :|.....|..|....|...|..|
  Rat   243 PPGGAVPSGVPAAAREGRLPSGLSASPQPSSIAPLRPQ 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 25/52 (48%)
Pdx1NP_074043.4 Transactivation domain 13..73
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 36..81 62/233 (27%)
Antp-type hexapeptide 118..123 1/4 (25%)
Homeobox 149..203 CDD:395001 26/53 (49%)
Nuclear localization signal. /evidence=ECO:0000250 197..203 5/5 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..283 17/80 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.