DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and Hmx2

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001099773.1 Gene:Hmx2 / 293538 RGDID:1565366 Length:273 Species:Rattus norvegicus


Alignment Length:330 Identity:71/330 - (21%)
Similarity:103/330 - (31%) Gaps:135/330 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 SFSVDRLLGSEPEESHRQSSSSPSTKSCCDGSILACCSFPHCFSQANAESRRFGHATLPPTFTPT 137
            ||::..:||..|.|:.|:.:..|:.|.                                 :.:.:
  Rat    19 SFTIQSILGGGPSEAPREPAGWPARKR---------------------------------SLSVS 50

  Fly   138 SSHTYPFVGLDKLFPGPYMDYKSVLRPTPIRAAEHAAPTYPTLATNALLRFHQHQKQQHQQHHHH 202
            |....|..|...  |..|.       |.|                                    
  Rat    51 SEEEEPEEGWKA--PACYC-------PDP------------------------------------ 70

  Fly   203 QHHPKHLHQQHKPP--------PHNSTTA-------SALLAPLHSLTSLQLTQQQQRFLGKTPQQ 252
             |.||....:|.||        |..|..|       :..|:|.|.    ...::::|.|      
  Rat    71 -HGPKEPSPKHHPPIPFPCLGTPKGSGGAGPAASERTPFLSPSHP----DFKEEKERLL------ 124

  Fly   253 LLDIAPT-SPAAAAAATSQNGAHGHGGGNGQGNASAGSNGKRKRSWSRAVFSNLQRKGLEIQFQQ 316
                 |. ||:.........||....|.           .|:|   :|.|||..|...||..|..
  Rat   125 -----PAGSPSPGPERPRDGGAERQAGA-----------AKKK---TRTVFSRSQVYQLESTFDM 170

  Fly   317 QKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKWRHTRENLKSGQEKQPSAVPESGGVFKTSTPS 381
            ::|::..:|..||:.|.||:.|||.||||||.||:           :|.||..|:..:...|..:
  Rat   171 KRYLSSSERACLASSLQLTETQVKTWFQNRRNKWK-----------RQLSAELEAANMAHASAQT 224

  Fly   382 GDGTP 386
            ..|.|
  Rat   225 LVGMP 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 25/52 (48%)
Hmx2NP_001099773.1 Homeobox 152..206 CDD:395001 26/64 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.