DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and Hmx3

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001099772.1 Gene:Hmx3 / 293537 RGDID:1559927 Length:356 Species:Rattus norvegicus


Alignment Length:294 Identity:73/294 - (24%)
Similarity:105/294 - (35%) Gaps:82/294 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 PPTFTPTSSHTYPFVGLDKLFPGPYMDYKSVLR-PTPIRAAEHAAPTYPTLATNALLRFHQHQKQ 194
            |.|.||...|          .|.|....|::|| .:|....:..:|. |.|..:           
  Rat   119 PYTLTPAGGH----------LPRPEASEKALLRDSSPASGTDRDSPD-PLLKAD----------- 161

  Fly   195 QHQQHHHHQHHPKHLHQQHKPPPHNSTTASALLAPLHSLTSLQLTQQQQRFLGKTPQQLLDIAPT 259
                       |.|.....|.|..               ..|:.:..::   ||...:.:..|..
  Rat   162 -----------PDHKELDSKSPDE---------------IILEESDSEE---GKKEGEAVPGAAG 197

  Fly   260 SPAAAAAATSQNGAHGHGGGNGQGNASAGSNGKR---KRSWSRAVFSNLQRKGLEIQFQQQKYIT 321
            :...|.|||.         |:....|.|.|..|:   ::..:|.|||..|...||..|..::|::
  Rat   198 TTVGATAATP---------GSEDWKAGADSPEKKPACRKKKTRTVFSRSQVFQLESTFDMKRYLS 253

  Fly   322 KPDRRKLAARLNLTDAQVKVWFQNRRMKWRH------TRENLKSGQEKQPSAVP----ESGGVFK 376
            ..:|..|||.|:||:.|||:||||||.||:.      ...||.....::...||    |:.....
  Rat   254 SSERAGLAASLHLTETQVKIWFQNRRNKWKRQLAAELEAANLSHAAAQRIVRVPILYHENSAAEG 318

  Fly   377 TSTPSGDGTP--QEALD------YSSDSCSSVDL 402
            .:..:|...|  |..|.      ||....|||.|
  Rat   319 AAAAAGAPVPVSQPLLTFPHPVYYSHPVVSSVPL 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 26/52 (50%)
Hmx3NP_001099772.1 Homeobox 230..284 CDD:395001 27/53 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.