DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and Obox2

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_038953187.1 Gene:Obox2 / 292574 RGDID:1307972 Length:326 Species:Rattus norvegicus


Alignment Length:211 Identity:50/211 - (23%)
Similarity:81/211 - (38%) Gaps:51/211 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 TSLQLTQ-----------QQQRFLGKTPQQLLDIAPTSPAAAAAATSQNGAHGHGG-------GN 280
            ||.||.|           |......:||.|      :||:......:...:.|...       .:
  Rat    36 TSSQLPQEPAWNLAFQMGQSPLVTSRTPMQ------SSPSVPEQNLNWQESQGSSRESKPMALSD 94

  Fly   281 GQGNASAGSNGKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRR---KLAARLNLTDAQVKVW 342
            ..|....|....|||...|..:|..|:..|:..|.:.:|   ||::   :||:.:.:|:.::|||
  Rat    95 KYGGKQTGPVAPRKRRKERTQYSEKQKSVLQEHFAECQY---PDKKLCLELASLIRVTEKEIKVW 156

  Fly   343 FQNRRMKWRHTRENLKSGQEKQPSAVPESGGVFKTSTPSGD------------GTPQEALDYSSD 395
            |:|.|.|.:         |:..|.|:||..|..:..:.|.|            |.|........|
  Rat   157 FKNNRAKCK---------QKNVPEALPEKNGGSEAVSGSTDFPGSIAVVGGDQGEPMATAILDVD 212

  Fly   396 SCSSVDLSEQADEDDN 411
            |...::.|:::..|.|
  Rat   213 STPKLNCSQESSLDGN 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 18/55 (33%)
Obox2XP_038953187.1 HOX 109..165 CDD:197696 19/58 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.