DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and VENTX

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_055283.1 Gene:VENTX / 27287 HGNCID:13639 Length:258 Species:Homo sapiens


Alignment Length:139 Identity:39/139 - (28%)
Similarity:60/139 - (43%) Gaps:41/139 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   299 RAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKWRHTRENLKSGQEK 363
            |..|:..|.:.||..||..:|::..:|::||..:.|::.|:|.||||||||  |.|:.    |:.
Human    95 RTAFTMEQVRTLEGVFQHHQYLSPLERKRLAREMQLSEVQIKTWFQNRRMK--HKRQM----QDP 153

  Fly   364 QPSAVPESGGV------FKTSTPSGDG----------------------------TPQEALDYSS 394
            |..: |.||.:      :.||:...:|                            ..||||..:.
Human   154 QLHS-PFSGSLHAPPAFYSTSSGLANGLQLLCPWAPLSGPQALMLPPGSFWGLCQVAQEALASAG 217

  Fly   395 DSCSSVDLS 403
            .||....|:
Human   218 ASCCGQPLA 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 22/51 (43%)
VENTXNP_055283.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..93
Homeobox 95..147 CDD:306543 22/53 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 227..248 39/139 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.