DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and ALX3

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_006483.2 Gene:ALX3 / 257 HGNCID:449 Length:343 Species:Homo sapiens


Alignment Length:295 Identity:78/295 - (26%)
Similarity:98/295 - (33%) Gaps:105/295 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 HTYPF-VGLDKLFPGPYMDYKSVLRPTPIRAAEHAAPTYPTLATNALLRFHQHQKQQHQQHHHHQ 203
            |..|| ||   ..||||:  .|...|...:....|||                            
Human     5 HCAPFRVG---PAPGPYV--ASGDEPPGPQGTPAAAP---------------------------- 36

  Fly   204 HHPKHLHQQHKPPPHNSTTASALLAPLHSLTSLQLTQQQQRFL---GKTPQQLL-DIAP------ 258
                |||.  .||.....|......||            :.:|   .|.|.:.| |:.|      
Human    37 ----HLHP--APPRGPRLTRFPACGPL------------EPYLPEPAKPPAKYLQDLGPGPALNG 83

  Fly   259 ----TSPAAAAAATSQ-----------NGAHGHGGGNGQGN-----------ASAG-------SN 290
                ..||.|...||:           .|....|..|.||:           .|.|       :.
Human    84 GHFYEGPAEAEEKTSKAASFPQLPLDCRGGPRDGPSNLQGSPGPCLASLHLPLSPGLPDSMELAK 148

  Fly   291 GKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPD---RRKLAARLNLTDAQVKVWFQNRRMKWRH 352
            .|.|:..:|..||..|.:.||..||:..|   ||   |.:||.|.:||:|:|:|||||||.|||.
Human   149 NKSKKRRNRTTFSTFQLEELEKVFQKTHY---PDVYAREQLALRTDLTEARVQVWFQNRRAKWRK 210

  Fly   353 TRENLKSGQEKQPSAVPESGGVFKTSTPSGDGTPQ 387
            .....|..:.:.|........|.    |..|..||
Human   211 RERYGKIQEGRNPFTAAYDISVL----PRTDSHPQ 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 27/55 (49%)
ALX3NP_006483.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..104 33/149 (22%)
PRK12323 <13..131 CDD:237057 33/165 (20%)
Homeobox 157..210 CDD:365835 28/55 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.