DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and Otx1

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_037241.1 Gene:Otx1 / 25646 RGDID:3237 Length:355 Species:Rattus norvegicus


Alignment Length:142 Identity:47/142 - (33%)
Similarity:67/142 - (47%) Gaps:31/142 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   278 GGNGQGNASAGSN----------GKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPD---RRKLA 329
            |.||.|.|....:          ..||:...|..|:..|...||..|.:.:|   ||   |.::|
  Rat    11 GMNGLGLAGPAMDLLHPSVGYPATPRKQRRERTTFTRSQLDVLEALFAKTRY---PDIFMREEVA 72

  Fly   330 ARLNLTDAQVKVWFQNRRMKWRHTRENLKSGQ-------EKQPSAVPESGGVFKTSTPSGDGTPQ 387
            .::||.:::|:|||:|||.|   .|:..:||.       :|:.|.|.||.|    |..||..|| 
  Rat    73 LKINLPESRVQVWFKNRRAK---CRQQQQSGNGTKSRPVKKKSSPVRESSG----SESSGQFTP- 129

  Fly   388 EALDYSSDSCSS 399
            .|:..|:.|.||
  Rat   130 PAVSSSASSSSS 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 21/55 (38%)
Otx1NP_037241.1 Homeobox 42..94 CDD:278475 21/57 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 92..144 20/58 (34%)
TF_Otx 178..274 CDD:281521
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 257..306
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.