DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and Npm1

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_037124.1 Gene:Npm1 / 25498 RGDID:3192 Length:292 Species:Rattus norvegicus


Alignment Length:41 Identity:13/41 - (31%)
Similarity:20/41 - (48%) Gaps:3/41 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   376 KTSTP-SGDGTPQE--ALDYSSDSCSSVDLSEQADEDDNIE 413
            |.|.| .|:..||:  .||...|.....|..::.|:||:.:
  Rat   141 KRSAPGGGNKVPQKKVKLDEDDDEDDEDDEDDEDDDDDDFD 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475
Npm1NP_037124.1 Required for interaction with SENP3. /evidence=ECO:0000250 1..185 13/41 (32%)
Necessary for interaction with APEX1. /evidence=ECO:0000250 1..117
Nucleoplasmin 18..117 CDD:397268
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 138..248 13/41 (32%)
Nuclear localization signal. /evidence=ECO:0000255 152..157 2/4 (50%)
Nuclear localization signal. /evidence=ECO:0000255 190..196
Required for nucleolar localization. /evidence=ECO:0000250 241..292
NPM1-C 243..289 CDD:406641
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.