Protein Alignment H2.0 and Npm1

DIOPT Version :9

• Sequence 1: NP_523488.2
• Gene: H2.0 / 33841
• FlyBaseID: FBgn0001170
• Length: 418
• Species: Drosophila melanogaster
• Sequence 2: NP_037124.1
• Gene: Npm1 / 25498
• RGDID: 3192
• Length: 292
• Species: Rattus norvegicus
• Alignment Length: 41
• Identity: 13/41 - (31%)
• Similarity: 20/41 - (48%)
• Gaps: 3/41 - (7%)

  Fly   376 KTSTP-SGDGTPQE--ALDYSSDSCSSVDLSEQADEDDNIE 413
            |.|.| .|:..||:  .||...|.....|..::.|:||:.:
  Rat   141 KRSAPGGGNKVPQKKVKLDEDDDEDDEDDEDDEDDDDDDFD 181

Known Domains

Gene	Sequence	Domain	Region	External ID	Identity
H2.0	NP_523488.2	Homeobox	298..351	CDD:278475
Npm1	NP_037124.1	Required for interaction with SENP3. /evidence=ECO:0000250	1..185		13/41 (32%)
		Necessary for interaction with APEX1. /evidence=ECO:0000250	1..117
		Nucleoplasmin	18..117	CDD:397268
		Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite	138..248		13/41 (32%)
		Nuclear localization signal. /evidence=ECO:0000255	152..157		2/4 (50%)
		Nuclear localization signal. /evidence=ECO:0000255	190..196
		Required for nucleolar localization. /evidence=ECO:0000250	241..292
		NPM1-C	243..289	CDD:406641

Information from Original Tools

Tool	Simple Score	Weighted Score	Original Tool Information
			BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG0488
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900