DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and Obox6

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_663756.2 Gene:Obox6 / 252830 MGIID:2149036 Length:347 Species:Mus musculus


Alignment Length:267 Identity:61/267 - (22%)
Similarity:103/267 - (38%) Gaps:62/267 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 QHQQHHHHQHHPKHLH---------------QQHKPPPHN---STTASALLAP------LHSLTS 235
            |:.|..|....|. ||               |.|:.|..|   ....|.|:.|      .||:..
Mouse     3 QYNQSPHMPQDPS-LHSKFQMSSSAPIEISFQMHQEPARNLPFQMCQSPLVIPRSPMQSSHSVPE 66

  Fly   236 LQL-TQQQQRFLGKTPQQL---LDIAPTSP-----------AAAAAATSQNGAHGHGG----GNG 281
            ..| .|:.|...||:..|:   |.:.|..|           ...:.::.:.|..|..|    ...
Mouse    67 RDLCPQESQGPSGKSSIQMQPGLVMDPALPILRSLLMHSPHQIPSRSSVRAGFQGSLGPMVRSPS 131

  Fly   282 QGNASAGSNGKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNR 346
            .|:........||....|.|::..|:..|:..|.:..|.::..|..||..:.:|..::::||:|.
Mouse   132 YGDRRVSLVTPRKHRKIRTVYTEEQKCVLKKHFHKCTYPSREQRMALAVLVGVTANEIQIWFKNH 196

  Fly   347 RMKWRHTRENLKSGQEKQPSAVPESGGV---------FKTSTP---SGDGTPQEALDYSSDSCSS 399
            |.|.:  ||:|    :..|:|:||:.|.         |..|.|   |.:|....:..:..||..:
Mouse   197 RAKSK--RESL----QNVPAALPETNGSSEAVSESVHFPDSLPVVASANGESMWSGTFGEDSIPN 255

  Fly   400 VDLSEQA 406
            ::.|:::
Mouse   256 LNWSQES 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 15/52 (29%)
Obox6NP_663756.2 COG5576 86..>204 CDD:227863 25/119 (21%)
homeodomain 146..204 CDD:238039 16/59 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.