DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and OTP

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_115485.1 Gene:OTP / 23440 HGNCID:8518 Length:325 Species:Homo sapiens


Alignment Length:231 Identity:58/231 - (25%)
Similarity:84/231 - (36%) Gaps:68/231 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 HPKHLHQQHKPPPHNSTTASALLAPLHSLTSLQLTQQQQRFLGKTPQQLLDIAPTSPAAAAAATS 269
            ||..|      .|::.....|.|.|...:|:          :|.||..|          |.:|..
Human    41 HPGDL------APNSDPVEGATLLPGEDITT----------VGSTPASL----------AVSAKD 79

  Fly   270 QNGAHGHGGGNGQGNASAGSNGKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPD---RRKLAAR 331
            .:...|..||.....|.. ..|::|:...|..|:..|...||..|.:..|   ||   |.:||.|
Human    80 PDKQPGPQGGPNPSQAGQ-QQGQQKQKRHRTRFTPAQLNELERSFAKTHY---PDIFMREELALR 140

  Fly   332 LNLTDAQVKVWFQNRRMKWRHTRENLK-----------SGQEKQPSAVPESG------------- 372
            :.||:::|:|||||||.||:..::...           .|..:.|||...:.             
Human   141 IGLTESRVQVWFQNRRAKWKKRKKTTNVFRAPGTLLPTPGLPQFPSAAAAAAAAMGDSLCSFHAN 205

  Fly   373 ----------GVFKTSTPSGDGTPQEALDYSSDSCS 398
                      ||.:...|...|. |:|:..|...||
Human   206 DTRWAAAAMPGVSQLPLPPALGR-QQAMAQSLSQCS 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 24/55 (44%)
OTPNP_115485.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 32..112 21/97 (22%)
Homeobox 107..156 CDD:395001 21/51 (41%)
OAR 303..320 CDD:397759
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 306..319
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.