DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and Tlx2

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_033418.1 Gene:Tlx2 / 21909 MGIID:1350935 Length:284 Species:Mus musculus


Alignment Length:289 Identity:74/289 - (25%)
Similarity:100/289 - (34%) Gaps:99/289 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 HHHQHHP------KHLHQQHKPP-----------PHNSTTA-------SALLAPLHSLTSLQLTQ 240
            ||..||.      ..:....:||           .|..:.|       ::..||..||.||    
Mouse     9 HHLPHHEPISFGIDQILSGPEPPGGGLGPGQSGQSHGESAAFSSGFHGASGYAPAGSLASL---- 69

  Fly   241 QQQRFLGKTP--------QQLLDIAPTSPAAAAAATSQNGAHGHGGGNGQGNASAG------SNG 291
              .|..|..|        .:.|.:.|.|.||.|..    |..|.||..|    .||      .:|
Mouse    70 --PRGSGVGPGGVIRVPAHRPLPVPPPSGAAPAVP----GPSGLGGAGG----LAGLTFPWMDSG 124

  Fly   292 KR-----------------------------KRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRK 327
            :|                             ||...|..||..|...||.:|.:|||:...:|..
Mouse   125 RRFAKDRLTAALSPFSGTRRIGHPYQNRTPPKRKKPRTSFSRSQVLELERRFLRQKYLASAERAA 189

  Fly   328 LAARLNLTDAQVKVWFQNRRMKW-RHTRENLKSGQEK--------QPSAVPESGGVFKTSTPSGD 383
            ||..|.:||||||.||||||.|| |.|.|..::.:.:        |..|:|.         |...
Mouse   190 LAKALRMTDAQVKTWFQNRRTKWRRQTAEEREAERHRAGRLLLHLQQDALPR---------PLRP 245

  Fly   384 GTPQEALDYSSDSCSSVDLSEQADEDDNI 412
            ..|.:.|...:.|..::...:...||:.:
Mouse   246 PLPPDPLCLHNSSLFALQNLQPWAEDNKV 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 28/53 (53%)
Tlx2NP_033418.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..52 4/31 (13%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 78..104 6/29 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 140..166 4/25 (16%)
Homeobox 160..213 CDD:306543 27/52 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.