DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and EMX2

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_004089.1 Gene:EMX2 / 2018 HGNCID:3341 Length:252 Species:Homo sapiens


Alignment Length:330 Identity:81/330 - (24%)
Similarity:120/330 - (36%) Gaps:90/330 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 KLSFSVDRLLGSEP--EESHRQSSSSPSTKSCCDGSILACCSFPHCFSQANAESRRFGHATLPP- 132
            |..|:::.|:..:.  ..|..:....|:..|..:.|.:.  .|.:.|..|.|.:...|..:.|. 
Human     7 KRCFTIESLVAKDSPLPASRSEDPIRPAALSYANSSPIN--PFLNGFHSAAAAAAGRGVYSNPDL 69

  Fly   133 TFTPTSSHTYPFVGLDKLFPGPYMDYKSVLRPTPIRAAEHAAPTYPTLATNALLRFHQHQKQQHQ 197
            .|....||.                      |.|      |.|.:|....:||        ..|.
Human    70 VFAEAVSHP----------------------PNP------AVPVHPVPPPHAL--------AAHP 98

  Fly   198 QHHHHQHHPKHLHQQHKPPPHNSTTASALLAPLHSLTSLQLTQQQQRFLGKTPQQLLDIAPTSPA 262
            ....|..||....||..|    ||....|:             .:.|:||...|.    ..|||.
Human    99 LPSSHSPHPLFASQQRDP----STFYPWLI-------------HRYRYLGHRFQG----NDTSPE 142

  Fly   263 AAAAATSQNGAHGHGGGNGQGNASAGSNGKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRK 327
            :...         |       ||.|     ||....|..||..|...||..|::..|:...:|::
Human   143 SFLL---------H-------NALA-----RKPKRIRTAFSPSQLLRLEHAFEKNHYVVGAERKQ 186

  Fly   328 LAARLNLTDAQVKVWFQNRRMKWRHTRENLKSGQEKQPSAVPESG--GVFKTSTPSGDGTPQEAL 390
            ||..|:||:.||||||||||.|::  |:.|:  :|...|...:.|  .:.:....:...:|:| :
Human   187 LAHSLSLTETQVKVWFQNRRTKFK--RQKLE--EEGSDSQQKKKGTHHINRWRIATKQASPEE-I 246

  Fly   391 DYSSD 395
            |.:||
Human   247 DVTSD 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 25/52 (48%)
EMX2NP_004089.1 Homeobox 158..211 CDD:395001 25/54 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 212..252 9/43 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.