Sequence 1: | NP_523488.2 | Gene: | H2.0 / 33841 | FlyBaseID: | FBgn0001170 | Length: | 418 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_508525.3 | Gene: | ceh-31 / 191621 | WormBaseID: | WBGene00000452 | Length: | 260 | Species: | Caenorhabditis elegans |
Alignment Length: | 252 | Identity: | 60/252 - (23%) |
---|---|---|---|
Similarity: | 98/252 - (38%) | Gaps: | 92/252 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 210 HQQHKPPPHNSTTASALLAPLHSLTSLQLTQQQQRFLGKTPQQLLDIAPTSPAAAAAATSQNGAH 274
Fly 275 GHGGGNGQGNASAGSNGKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQV 339
Fly 340 KVWFQNRRMKWR----------HTRENLKSGQE-----------------------KQP------ 365
Fly 366 ----SAVPESGG-----VFKTSTPSGD--GTPQEALDYSSDSCSSVDLS-EQADEDD 410 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
H2.0 | NP_523488.2 | Homeobox | 298..351 | CDD:278475 | 26/52 (50%) |
ceh-31 | NP_508525.3 | Homeobox | 98..150 | CDD:278475 | 26/51 (51%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0488 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |