DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and ceh-30

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_508524.2 Gene:ceh-30 / 191620 WormBaseID:WBGene00000451 Length:237 Species:Caenorhabditis elegans


Alignment Length:292 Identity:69/292 - (23%)
Similarity:107/292 - (36%) Gaps:101/292 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 LFPGPYMDYKSVLRPTPIRAAEHAAPTYP--TLATNALLRFHQHQKQQ-HQQHHHHQHHPKHLHQ 211
            |.|..|:|      ||.......||.|.|  .:::::..|.....:|. :...|.:.|.|     
 Worm    10 LLPAFYLD------PTTQALLAQAASTSPCNKISSSSSFRISDILEQSPNNSSHSNDHDP----- 63

  Fly   212 QHKPPPHNSTTASALLAPLHSLTSLQLTQQQQRFLGKTPQQLLDIAPTSPAAAAAATSQNGAHGH 276
                                                 :||.:.....|||.|::.          
 Worm    64 -------------------------------------SPQSIKSDFSTSPRASSP---------- 81

  Fly   277 GGGNGQGNASAGSNGKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKV 341
             ||:..|  |.||..|.::  :|.:|::.|.:.||..|::|||::..||..||.|:.|||.|||.
 Worm    82 -GGDRMG--SPGSCKKSRK--ARTIFTDKQLQELENTFEKQKYLSVQDRMDLAHRMGLTDTQVKT 141

  Fly   342 WFQNRRMKWRHTRENLKSGQEKQPSAVPESGGV---------------FKTSTPSGDGTPQEALD 391
            |:||||.||   :....||.:    .:.|.|.:               :.|:.|.|...|...|.
 Worm   142 WYQNRRTKW---KRQATSGMD----LLSEPGNLSAVQNLIRSSPYWANYITALPMGTQLPMMGLP 199

  Fly   392 Y-------------SSDSCSSVDLSEQADEDD 410
            .             ||.:..|..:|.::.:.|
 Worm   200 MSMIVPPAHAFQPSSSSNSPSTHISSESPQLD 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 26/52 (50%)
ceh-30NP_508524.2 Homeobox 99..151 CDD:278475 27/54 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.