DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and ceh-1

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_508796.2 Gene:ceh-1 / 191614 WormBaseID:WBGene00000428 Length:171 Species:Caenorhabditis elegans


Alignment Length:119 Identity:37/119 - (31%)
Similarity:55/119 - (46%) Gaps:19/119 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   267 ATSQNGAHGHGGGNGQGNASAGSNGKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAAR 331
            :.|....|.....:|     ..|:.|.|...:|..|:..|...||.:|:..:|::..:|..||.:
 Worm    17 SNSDEATHQKSPADG-----GKSSRKLKMRRARTAFTYEQLVALENKFKTSRYLSVVERLNLAIQ 76

  Fly   332 LNLTDAQVKVWFQNRRMKWRHTRENLKSGQEKQPSAVPESGGVFKTSTPSGDGT 385
            |.|::.|||:||||||.||:  :.|  .||:......|          ||.|.|
 Worm    77 LQLSETQVKIWFQNRRTKWK--KHN--PGQDANTPQTP----------PSSDET 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 22/52 (42%)
ceh-1NP_508796.2 COG5576 2..118 CDD:227863 37/119 (31%)
Homeobox 44..96 CDD:278475 22/51 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.