DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and pha-2

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_508131.4 Gene:pha-2 / 187454 WormBaseID:WBGene00004011 Length:214 Species:Caenorhabditis elegans


Alignment Length:205 Identity:60/205 - (29%)
Similarity:84/205 - (40%) Gaps:38/205 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 LHQQHKPPPHNSTTASALLAPLHSLTSL----------QLTQQQQRFLGKTPQQLLDIAP---TS 260
            |.|:..|......|:|....|..|..||          ::...::.|.|     .||..|   ..
 Worm    10 LLQEDTPSKEKPETSSESPIPTGSECSLNESSDTTLDQKMEPNKKMFNG-----TLDFNPWICHV 69

  Fly   261 PAAAAAATSQNGAHGHGGGNG------QGNASAG--------------SNGKRKRSWSRAVFSNL 305
            ....||..||||.:..|..|.      ..|.:.|              |...:||...:..|:|.
 Worm    70 SQQLAAQLSQNGKNRPGAPNQVPLLNMNVNQTMGNMWDPRLSWLYPYMSKSPQKRKGGQIRFTNE 134

  Fly   306 QRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKWRHTRENLKSGQEKQPSAVPE 370
            |...||.:|...||::..:|:|||..|:|::.|||.||||||.|||..|::.:...|....|...
 Worm   135 QTDALEHKFDSHKYLSPQERKKLAKSLSLSERQVKTWFQNRRAKWRRVRKDGEDEDEMPNGASAR 199

  Fly   371 SGGVFKTSTP 380
            |.|..::|.|
 Worm   200 SLGQLQSSNP 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 24/52 (46%)
pha-2NP_508131.4 Homeobox 130..181 CDD:365835 25/50 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.