powered by:
Protein Alignment H2.0 and pax-1
DIOPT Version :9
Sequence 1: | NP_523488.2 |
Gene: | H2.0 / 33841 |
FlyBaseID: | FBgn0001170 |
Length: | 418 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_505120.1 |
Gene: | pax-1 / 187105 |
WormBaseID: | WBGene00003937 |
Length: | 257 |
Species: | Caenorhabditis elegans |
Alignment Length: | 43 |
Identity: | 12/43 - (27%) |
Similarity: | 22/43 - (51%) |
Gaps: | 12/43 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 190 QHQKQQH-QQHHHHQHHPKHLHQ-----------QHKPPPHNS 220
:.|:||| |||.:.:::...|:| .:.||.::|
Worm 209 EQQQQQHLQQHQYMEYNNNELNQISGNLDYQVSSSNTPPSYDS 251
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
H2.0 | NP_523488.2 |
Homeobox |
298..351 |
CDD:278475 |
|
pax-1 | NP_505120.1 |
PAX |
61..185 |
CDD:128645 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.