DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and ceh-27

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001256348.1 Gene:ceh-27 / 185853 WormBaseID:WBGene00000449 Length:263 Species:Caenorhabditis elegans


Alignment Length:207 Identity:58/207 - (28%)
Similarity:83/207 - (40%) Gaps:68/207 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 PHN----STTASALLAPLHSLTSLQLT-----QQQQRFLGKTPQQLLDIAPTSPAAAAAATSQNG 272
            ||:    :|:|:...||....|..||.     |..|..||.|.||.:.|:               
 Worm    48 PHDFSSYNTSAAYATAPYPMATHPQLANFNRFQTNQLNLGLTTQQNMMIS--------------- 97

  Fly   273 AHGHGGGNGQGNASAGSNGKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDA 337
                               :|||   |.:||..|...||.:||..:|::..||..||..:||:..
 Worm    98 -------------------RRKR---RVLFSPQQVHVLERKFQINRYLSAADRENLAKSINLSAT 140

  Fly   338 QVKVWFQNRRMKWRHTRENLKSGQEKQPSAVPESGGVFKTSTPSGDGTPQEALDYSSDSCSSV-- 400
            |||:||||:|.|.:.        |||:...   .||.::.|....|.      |..:||..|:  
 Worm   141 QVKIWFQNQRYKCKR--------QEKEKKM---DGGCYRDSDRDTDS------DRDNDSSGSLGS 188

  Fly   401 ---DLSEQADED 409
               .:.::.|||
 Worm   189 SMSGIKKEEDED 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 24/52 (46%)
ceh-27NP_001256348.1 homeodomain 99..157 CDD:238039 27/68 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.