DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and dsc-1

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_510497.1 Gene:dsc-1 / 181599 WormBaseID:WBGene00001096 Length:310 Species:Caenorhabditis elegans


Alignment Length:291 Identity:70/291 - (24%)
Similarity:96/291 - (32%) Gaps:106/291 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 QQHHHHQHHPKHL-----------HQQH--KPPP---HNSTTASALLAPLHSLTSLQLTQQQQRF 245
            ||.....|.|::|           ..||  :||.   ||...|      ||:  ..|::.|    
 Worm    38 QQGAQQFHPPRNLGPQLARRWSCGDSQHADEPPASYYHNLGVA------LHN--HFQMSNQ---- 90

  Fly   246 LGKTPQQLLDI-APT--SPAAAAAATSQ-----------------NGAHGHGG------------ 278
                 ..|.|. .||  ||.::|..|.|                 ...|.:|.            
 Worm    91 -----HYLSDFDCPTTVSPISSAHETGQLPQLSPYDHIGNQDPHMFSPHAYGNSMIPDNSYFENA 150

  Fly   279 ---------GNGQGNAS------AGSNGKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKL 328
                     ||...|.|      |.|.|.|:|  .|..|:.||...||..|::..|.....::.:
 Worm   151 SRSISAPNVGNSTLNPSLMSSDNAQSCGGRRR--FRTNFTELQSTFLEDSFKESHYPDHKAKKYM 213

  Fly   329 AARLNLTDAQVKVWFQNRRMKWR--------HTR-ENLKSGQEKQPSAV-----PESGGVFKTST 379
            |..|.:.:.::.|||||||.|||        .|| |:...|......|.     |:.|.  ....
 Worm   214 ADFLKIPEDRITVWFQNRRAKWRRKEHRQRDRTRNESFSGGSNSFDFACFSAQHPDDGP--NAKH 276

  Fly   380 PSGDGTPQEALDYSSDSCSSVDLSEQADEDD 410
            |:..|.|.:.:        |:|......|.|
 Worm   277 PNSFGIPNQPM--------SLDQFPMNTEQD 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 18/52 (35%)
dsc-1NP_510497.1 Homeobox 184..236 CDD:278475 18/51 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.