DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and ceh-14

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_509273.1 Gene:ceh-14 / 181012 WormBaseID:WBGene00000438 Length:351 Species:Caenorhabditis elegans


Alignment Length:133 Identity:37/133 - (27%)
Similarity:57/133 - (42%) Gaps:31/133 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 GSNGKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPD---RRKLAARLNLTDAQVKVWFQNRRMK 349
            ||| ||.|       :.:..|.||...|..:..:||.   |.:||:...|....|:|||||||.|
 Worm   178 GSN-KRPR-------TTISAKSLETLKQAYQTSSKPARHVREQLASETGLDMRVVQVWFQNRRAK 234

  Fly   350 WRHTRENLKSGQEKQPSAVPESGGVFKTS--TPSGDGTPQEALDYSSDSCSSVDLSEQADEDDNI 412
            .:..::              ::|..:|:|  ..|...:|.|:::..|.:...:|    ...||..
 Worm   235 EKRLKK--------------DAGRRWKSSNRAESDSNSPIESINGQSPNYLYLD----HPMDDGN 281

  Fly   413 EIN 415
            |.|
 Worm   282 ESN 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 19/55 (35%)
ceh-14NP_509273.1 LIM 48..103 CDD:278823
LIM2_Lhx3_Lhx4 107..163 CDD:188762
COG5576 <172..295 CDD:227863 37/133 (28%)
Homeobox 183..236 CDD:278475 20/59 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.