DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and nob-1

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001369824.1 Gene:nob-1 / 176641 WormBaseID:WBGene00003779 Length:243 Species:Caenorhabditis elegans


Alignment Length:326 Identity:72/326 - (22%)
Similarity:110/326 - (33%) Gaps:121/326 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 VNVDHELPTKESCASTTIVSTS---PTSATSTTKVKLSFSVDRLLGSEPEESHRQSSSSPSTKSC 100
            :|.|....:|||.  |::..|.   |::|.:...::         |....|...::.|||.....
 Worm     9 INNDSPEDSKESI--TSVQQTPFFWPSAAAAIPSIQ---------GESRSERESETGSSPQLAPS 62

  Fly   101 CDGSILACCSFPHCFSQANAESRRFGHATLPPTFTPTSSHTYPFVGLDKLFPGPYMDYKSVLRPT 165
            ..|.::          ...|....||     |:..||::..           |..|:        
 Worm    63 STGMVM----------PGTAGMYGFG-----PSRMPTANEF-----------GMMMN-------- 93

  Fly   166 PIRAAEHAAPTYPTLATNALLRFHQHQKQQHQQHHHHQHHPKHLHQQHKPPPHNSTTASALLAPL 230
                     |.|.....|.|.....:...|..|.                      ||:      
 Worm    94 ---------PVYTDFYQNPLASTGWYSYGQPYQF----------------------TAN------ 121

  Fly   231 HSLTSLQLTQQQQRFLGKTPQQLLDIAPTSPAAAAAATSQNGA-H-----GHGGGNGQGNASAGS 289
            :|:.||.             ..|.||...:.|.::|||:.|.| |     .|             
 Worm   122 YSIPSLD-------------GNLSDITIPTTAGSSAATTPNAAMHLPWAISH------------- 160

  Fly   290 NGKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKWRHTR 354
            :||:||.    .:...|...||.::...:|:|...|.:|:|:|.|.:.||||||||||||.:..|
 Worm   161 DGKKKRQ----PYKKDQISRLEYEYSVNQYLTNKRRSELSAQLMLDEKQVKVWFQNRRMKDKKLR 221

  Fly   355 E 355
            :
 Worm   222 Q 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 22/52 (42%)
nob-1NP_001369824.1 Homeobox 165..219 CDD:395001 24/57 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.