Sequence 1: | NP_523488.2 | Gene: | H2.0 / 33841 | FlyBaseID: | FBgn0001170 | Length: | 418 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_499573.1 | Gene: | php-3 / 176640 | WormBaseID: | WBGene00004024 | Length: | 275 | Species: | Caenorhabditis elegans |
Alignment Length: | 238 | Identity: | 56/238 - (23%) |
---|---|---|---|
Similarity: | 79/238 - (33%) | Gaps: | 96/238 - (40%) |
- Green bases have known domain annotations that are detailed below.
Fly 199 HHHHQHHPKHLHQQHKPPPHNSTTASALLAPL-HSLTSLQLTQQQQRFLG--------------- 247
Fly 248 -----------------KTPQQLLDIAP-------TSPAAAAAAT-------------------- 268
Fly 269 ---------------------------SQNGAHGHGGGNGQGNASAGSNGKRKRSWSRAVFSNLQ 306
Fly 307 RKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMK 349 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
H2.0 | NP_523488.2 | Homeobox | 298..351 | CDD:278475 | 24/52 (46%) |
php-3 | NP_499573.1 | Homeobox | 202..256 | CDD:365835 | 24/55 (44%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |