DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and DLX2

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_004396.1 Gene:DLX2 / 1746 HGNCID:2915 Length:328 Species:Homo sapiens


Alignment Length:263 Identity:69/263 - (26%)
Similarity:97/263 - (36%) Gaps:103/263 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 HHHQHHPKHLHQQHKPPPH--------NSTTASALLAPLHSLTSLQLTQQQQRFLGKTPQQLLDI 256
            |..|......:.||:.||.        ||:::|:|..|..|                        
Human    13 HSTQIAASSTYHQHQQPPSGGGAGPGGNSSSSSSLHKPQES------------------------ 53

  Fly   257 APTSPAAAAAATS--QNGAHGHGGGNGQGN--ASAGS---------------------------- 289
             ||.|.:.|..:|  .|..|..|||.|.|:  |..||                            
Human    54 -PTLPVSTATDSSYYTNQQHPAGGGGGGGSPYAHMGSYQYQASGLNNVPYSAKSSYDLGYTAAYT 117

  Fly   290 ----------------------------NGKRKR-SWSRAVFSNLQRKGLEIQFQQQKYITKPDR 325
                                        |||.|: ...|.::|:.|...|:.:||:.:|:..|:|
Human   118 SYAPYGTSSSPANNEPEKEDLEPEIRIVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPER 182

  Fly   326 RKLAARLNLTDAQVKVWFQNRRMKWRHTRENLKSGQ---EKQP--SAVPESGGVFKTSTPSGD-G 384
            .:|||.|.||..|||:||||||.|:   ::..|||:   |:.|  ||.|.......::..|.| |
Human   183 AELAASLGLTQTQVKIWFQNRRSKF---KKMWKSGEIPSEQHPGASASPPCASPPVSAPASWDFG 244

  Fly   385 TPQ 387
            .||
Human   245 VPQ 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 25/52 (48%)
DLX2NP_004396.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 16..81 22/89 (25%)
DLL_N 51..132 CDD:289198 16/105 (15%)
Homeobox 155..208 CDD:278475 25/55 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 211..270 13/37 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 300..328
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.