DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and GSX2

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_573574.2 Gene:GSX2 / 170825 HGNCID:24959 Length:304 Species:Homo sapiens


Alignment Length:229 Identity:65/229 - (28%)
Similarity:93/229 - (40%) Gaps:65/229 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 HHHQHHPKHLHQQHKPPPHNSTTASALLAPLHSLTSLQLTQQQQRFLGKTPQQLLDIAPTSPAAA 264
            |||.|.|:|.|..|:|....|..|:|..|...:..:.         ||.         |...|..
Human   126 HHHHHPPQHHHHHHQPQQPGSAAAAAAAAAAAAAAAA---------LGH---------PQHHAPV 172

  Fly   265 AAATSQNGA---HGHGGGNGQGNASAGSNGKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRR 326
            ..||:.|.|   ..|....|..:||...||||.|:    .|::.|...||.:|....|:::..|.
Human   173 CTATTYNVADPRRFHCLTMGGSDASQVPNGKRMRT----AFTSTQLLELEREFSSNMYLSRLRRI 233

  Fly   327 KLAARLNLTDAQVKVWFQNRRMKWRHTRENLKSGQEKQPSAVPESGGVFKTSTPSGDGTPQEALD 391
            ::|..|||::.|||:||||||:|  |.:|                          |.||.:.:  
Human   234 EIATYLNLSEKQVKIWFQNRRVK--HKKE--------------------------GKGTQRNS-- 268

  Fly   392 YSSDSC--SSVDLSEQADED--------DNIEIN 415
            ::...|  |.|..:...|||        |:.||:
Human   269 HAGCKCVGSQVHYARSEDEDSLSPASANDDKEIS 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 21/52 (40%)
GSX2NP_573574.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..151 11/24 (46%)
Homeobox 206..258 CDD:306543 22/57 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 283..304 6/20 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.