DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and tlx2

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_005173139.1 Gene:tlx2 / 170781 ZFINID:ZDB-GENE-020208-1 Length:309 Species:Danio rerio


Alignment Length:330 Identity:77/330 - (23%)
Similarity:106/330 - (32%) Gaps:134/330 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 LSFSVDRLL-GSEPEESHRQSSSS--PS---------TKSCCDG--SILACCSFPHCFS------ 116
            :||.:|::| ||:      ||||.  ||         |.:..:|  |:...||.....:      
Zfish    19 ISFGIDQILNGSD------QSSSCMLPSRTGDPDYALTPNVYNGYNSMYPACSMAAGLAGSYNVN 77

  Fly   117 ---------QANAESRRFG-------HATLPPT-FTPTSSHTYPFVGLDKLFPGPYMDYKSVLRP 164
                     ..|..|...|       |..:||. ..||:.|                       |
Zfish    78 MNMNVSMNMNVNVNSGNAGGVIRVPAHRPMPPAPHQPTAGH-----------------------P 119

  Fly   165 TPIRAAEHAAPTYPTLATNALLRFHQHQKQQHQQHHHHQHHPKHLHQQHKPPPHNSTTASALLAP 229
            ..|.|.....||.|::.:                                  ||:.|        
Zfish   120 PSIAAGIPTMPTVPSMGS----------------------------------PHSFT-------- 142

  Fly   230 LHSLTSLQLTQQQQRFLGKTPQQLLDIAPTSPAAAAAATSQNGAHGHGGGNGQGNASAGSNGKRK 294
                  ....:..:||           |.....||.:..|.....||...|       .:..|||
Zfish   143 ------FPWMESSRRF-----------AKDRLTAALSPFSVTRRIGHPYQN-------RTPPKRK 183

  Fly   295 RSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKWRHTRENLKS 359
            :  .|..||.:|...||.:|.:|||:...:|..||..|.:||||||.||||||.|||......:.
Zfish   184 K--PRTSFSRVQICELEKRFHRQKYLASAERATLAKALKMTDAQVKTWFQNRRTKWRRQTAEERE 246

  Fly   360 GQEKQ 364
            .:.:|
Zfish   247 AERQQ 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 27/52 (52%)
tlx2XP_005173139.1 Homeobox 185..238 CDD:278475 27/52 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.