DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and Lhx3

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001034742.1 Gene:Lhx3 / 16871 MGIID:102673 Length:402 Species:Mus musculus


Alignment Length:133 Identity:36/133 - (27%)
Similarity:49/133 - (36%) Gaps:35/133 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 AGSNGKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPD-----RRKLAARLNLTDAQVKVWFQNR 346
            |.:..||.|       :.:..|.||.  .:..|.|.|.     |.:|::...|....|:||||||
Mouse   158 AEATAKRPR-------TTITAKQLET--LKSAYNTSPKPARHVREQLSSETGLDMRVVQVWFQNR 213

  Fly   347 RMK------------W-------RHTRENLKSGQEKQPSAVPESGGVFKTSTPS-GDGTPQEALD 391
            |.|            |       :.:|.:.||.::...........|..|..|| .|..|...| 
Mouse   214 RAKEKRLKKDAGRQRWGQYFRNMKRSRGSSKSDKDSIQEGQDSDAEVSFTDEPSMADMGPANGL- 277

  Fly   392 YSS 394
            |||
Mouse   278 YSS 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 19/76 (25%)
Lhx3NP_001034742.1 LIM1_Lhx3b 33..87 CDD:188851
LIM2_Lhx3_Lhx4 95..150 CDD:188762
Homeobox 165..218 CDD:278475 19/61 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.