DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and Lbx1

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_034821.2 Gene:Lbx1 / 16814 MGIID:104867 Length:282 Species:Mus musculus


Alignment Length:281 Identity:72/281 - (25%)
Similarity:97/281 - (34%) Gaps:103/281 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 HKPPPHNSTT------------------------ASALLAPL--HSLTSLQLTQQQQRFLGKTPQ 251
            |.|||.||..                        |:.|||..  |:...|.|..:..        
Mouse    22 HLPPPANSNKPLTPFSIEDILNKPSVRRSYSLCGAAHLLAAADKHAPGGLPLAGRAL-------- 78

  Fly   252 QLLDIAPTSPAAA----AAATSQ-------NGAHGHGGGNGQGNASAGSNGKRKRSWSRAVFSNL 305
                ::.|||..|    |:.|.:       ..|.|..|....|....    .:||..||..|:|.
Mouse    79 ----LSQTSPLCALEELASKTFKGLEVSVLQAAEGRDGMTIFGQRQT----PKKRRKSRTAFTNH 135

  Fly   306 QRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKWRHTRENLKS----------- 359
            |...||.:|..|||::..||.::|.:|.||:|||..||||||.|.:...|.:|:           
Mouse   136 QIYELEKRFLYQKYLSPADRDQIAQQLGLTNAQVITWFQNRRAKLKRDLEEMKADVESAKKLGPS 200

  Fly   360 ---------------------------------GQEKQPSAVPES--GGVFKTSTPSGDGTPQEA 389
                                             |....|...|::  ||..:.| |:...|.|.|
Mouse   201 GQMDIVALAELEQNSEASGGGGGGGCGRAKSRPGSPALPPGAPQAPGGGPLQLS-PASPLTDQRA 264

  Fly   390 LDYSSDSCSSVDLSEQADEDD 410
               ||..||..:..|:.|.||
Mouse   265 ---SSQDCSEDEEDEEIDVDD 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 27/52 (52%)
Lbx1NP_034821.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36 6/13 (46%)
Homeobox 128..182 CDD:395001 27/53 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..282 16/75 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.