DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and NKX6-3

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001351770.1 Gene:NKX6-3 / 157848 HGNCID:26328 Length:265 Species:Homo sapiens


Alignment Length:198 Identity:60/198 - (30%)
Similarity:78/198 - (39%) Gaps:59/198 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 TPQQLLDIAPTSPAAAAAATSQNG---AHGHGGGNGQ--------GNASAGSN------------ 290
            ||..:.||. :.|.||...:..:|   ..|.||.:.|        ||.|...|            
Human    51 TPHGITDIL-SRPVAAPNNSLLSGYPHVAGFGGLSSQGVYYSPQVGNFSKAGNEYPTRTRNCWAD 114

  Fly   291 -------GKR-------------KRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLT 335
                   |::             |:..:|..|:..|...||..|:|.||:..|:|.:||..|.:|
Human   115 TGQDWRGGRQCSNTPDPLSDSIHKKKHTRPTFTGHQIFALEKTFEQTKYLAGPERARLAYSLGMT 179

  Fly   336 DAQVKVWFQNRRMKWRHTRENLKSGQEKQPSAVPESGGVFKTSTPSGDGTPQE--------ALDY 392
            ::||||||||||.|||.     ||..|...|.....||.  .:...||..|.|        .||.
Human   180 ESQVKVWFQNRRTKWRK-----KSALEPSSSTPRAPGGA--GAGAGGDRAPSENEDDEYNKPLDP 237

  Fly   393 SSD 395
            .||
Human   238 DSD 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 26/52 (50%)
NKX6-3NP_001351770.1 Homeobox 142..195 CDD:306543 26/52 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.