DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and Hoxb7

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_034590.2 Gene:Hoxb7 / 15415 MGIID:96188 Length:217 Species:Mus musculus


Alignment Length:121 Identity:42/121 - (34%)
Similarity:59/121 - (48%) Gaps:25/121 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 QQLLDIAPTSPAAAAAATSQNGAHGHGGGNGQGNASAGSNGK-----------RKRSWSRAVFSN 304
            |.|..:.|..||.||.|..|.          ..:.:|.||.:           |||  .|..::.
Mouse    94 QNLSGVCPGDPAKAAGAKEQR----------DSDLAAESNFRIYPWMRSSGPDRKR--GRQTYTR 146

  Fly   305 LQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKWRHTRENLKSG 360
            .|...||.:|...:|:|:..|.::|..|.||:.|:|:|||||||||:  :||..||
Mouse   147 YQTLELEKEFHYNRYLTRRRRIEIAHTLCLTERQIKIWFQNRRMKWK--KENKTSG 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 22/52 (42%)
Hoxb7NP_034590.2 Antp-type hexapeptide 126..131 0/4 (0%)
Homeobox 141..194 CDD:365835 23/54 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 192..217 5/11 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.