DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and Hoxa9

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001264167.1 Gene:Hoxa9 / 15405 MGIID:96180 Length:295 Species:Mus musculus


Alignment Length:162 Identity:45/162 - (27%)
Similarity:66/162 - (40%) Gaps:31/162 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 PHNSTTASALLAPLHSLTSLQLTQQQQRFLGKTPQQLL---DIAPTSPAA--------------- 263
            |:..|:..|..:|.......:.||..:|    .|.:.|   .|..|:|..               
Mouse   128 PNTPTSVLAASSPRRRCLVPRGTQCTRR----APMRCLLQCIITTTTPTCIPRRPWRRRRRTAVD 188

  Fly   264 -----AAAATSQNGAHGHGGGN----GQGNASAGSNGKRKRSWSRAVFSNLQRKGLEIQFQQQKY 319
                 :..|.|:|.|....||:    ...|.:|.....|.....|..::..|...||.:|....|
Mouse   189 REKQPSEGAFSENNAENESGGDKPPIDPNNPAANWLHARSTRKKRCPYTKHQTLELEKEFLFNMY 253

  Fly   320 ITKPDRRKLAARLNLTDAQVKVWFQNRRMKWR 351
            :|:..|.::|..||||:.|||:||||||||.:
Mouse   254 LTRDRRYEVARLLNLTERQVKIWFQNRRMKMK 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 24/52 (46%)
Hoxa9NP_001264167.1 Hox9_act <190..216 CDD:282473 6/25 (24%)
Homeobox 232..285 CDD:278475 24/52 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.