Sequence 1: | NP_523488.2 | Gene: | H2.0 / 33841 | FlyBaseID: | FBgn0001170 | Length: | 418 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_064328.2 | Gene: | Mnx1 / 15285 | MGIID: | 109160 | Length: | 404 | Species: | Mus musculus |
Alignment Length: | 268 | Identity: | 75/268 - (27%) |
---|---|---|---|
Similarity: | 102/268 - (38%) | Gaps: | 66/268 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 200 HHHQH-----------------------HP------KHLHQQ-----HKPPPHNSTTASALLAPL 230
Fly 231 HSLTSLQLTQQQQRFLGKTPQQLLDIAPTSPAAAAAATSQNGAHGHGGGNG-------QGNASAG 288
Fly 289 SN--GKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKWR 351
Fly 352 HTRENLKSGQEKQPSAVPESGGVFKTSTPSGDGTPQEAL---DYSSDSCSS------VDLSEQAD 407
Fly 408 EDDNIEIN 415 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
H2.0 | NP_523488.2 | Homeobox | 298..351 | CDD:278475 | 26/52 (50%) |
Mnx1 | NP_064328.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 36..80 | ||
Homeobox | 244..297 | CDD:278475 | 26/52 (50%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 299..404 | 17/72 (24%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |