DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and Mnx1

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_064328.2 Gene:Mnx1 / 15285 MGIID:109160 Length:404 Species:Mus musculus


Alignment Length:268 Identity:75/268 - (27%)
Similarity:102/268 - (38%) Gaps:66/268 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 HHHQH-----------------------HP------KHLHQQ-----HKPPPHNSTTASALLAPL 230
            |||.|                       ||      ..|..|     |....:::..|:|.||..
Mouse   114 HHHAHPGAAAAAAAAAAAAAAGGLALGLHPGGAQGGAGLPAQAALYGHPVYSYSAAAAAAALAGQ 178

  Fly   231 HSLTSLQLTQQQQRFLGKTPQQLLDIAPTSPAAAAAATSQNGAHGHGGGNG-------QGNASAG 288
            |...|....|.|    |..|..     |..|....|:|.|..........|       ..::.|.
Mouse   179 HPALSYSYPQVQ----GAHPAH-----PADPIKLGASTFQLDQWLRASTAGMILPKMPDFSSQAQ 234

  Fly   289 SN--GKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKWR 351
            ||  ||.:|  .|..|::.|...||.||:..||:::|.|.::|..|.||:.|||:|||||||||:
Mouse   235 SNLLGKCRR--PRTAFTSQQLLELEHQFKLNKYLSRPKRFEVATSLMLTETQVKIWFQNRRMKWK 297

  Fly   352 HTRENLKSGQEKQPSAVPESGGVFKTSTPSGDGTPQEAL---DYSSDSCSS------VDLSEQAD 407
            .::   |:.::....|..:.||...|.....:...:|.|   ..|.|..|.      .|.....|
Mouse   298 RSK---KAKEQAAQEAEKQKGGGGGTGKGGSEEKTEEELMGPPVSGDKASGRRLRDLRDSDPDED 359

  Fly   408 EDDNIEIN 415
            |||..|.|
Mouse   360 EDDEEEDN 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 26/52 (50%)
Mnx1NP_064328.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 36..80
Homeobox 244..297 CDD:278475 26/52 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 299..404 17/72 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.