DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and dmbx1a

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_694509.1 Gene:dmbx1a / 142987 ZFINID:ZDB-GENE-020117-1 Length:388 Species:Danio rerio


Alignment Length:257 Identity:65/257 - (25%)
Similarity:94/257 - (36%) Gaps:91/257 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 NALLRFHQHQKQQHQQHHHHQHHPKHLHQQHKPPPHNSTTASALLAPLHSLTSLQLTQQQQRFLG 247
            :|:...||...||      .||.|     .::|..|..|.|                   :|..|
Zfish    18 SAMYNLHQQAAQQ------AQHAP-----DYRPSVHALTLA-------------------ERLAG 52

  Fly   248 KTPQQLLDIAPTSPAAAAAATSQNGAHGHGGGNGQGNASAGSNGKRKRSWSRAVFSNLQRKGLEI 312
            .|.|.::        ..|...||:                     ||:..||..|:..|.:.||.
Zfish    53 CTFQDII--------LEARYGSQH---------------------RKQRRSRTAFTAQQLEALEK 88

  Fly   313 QFQQQKYITKPD---RRKLAARLNLTDAQVKVWFQNRRMKWRHTRENLKSGQEKQPSAVPESGGV 374
            .||:..|   ||   |.:||...||.:|:|:|||:|||.|:|..:.:|:..|.::...|...|.:
Zfish    89 TFQKTHY---PDVVMRERLAMCTNLPEARVQVWFKNRRAKFRKKQRSLQKEQLQKQKDVSTDGAL 150

  Fly   375 F-----------------KTSTPSGDGTPQEALDYSSDSCSSVDL---------SEQADEDD 410
            .                 .:||.|......||..::..|..||:|         ||.|.||:
Zfish   151 AASDKDEAPSTLNLENQPPSSTSSSSSMEAEAAPHALGSELSVELNVTSAEQSGSESATEDN 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 25/55 (45%)
dmbx1aNP_694509.1 Homeobox 74..127 CDD:278475 25/55 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 129..272 18/84 (21%)
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 365..378
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.