DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and Dlx4

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_031893.3 Gene:Dlx4 / 13394 MGIID:94904 Length:240 Species:Mus musculus


Alignment Length:276 Identity:71/276 - (25%)
Similarity:99/276 - (35%) Gaps:88/276 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 PTFTPTSS--HTYPFVGLDKLFPG----PYMDY-KSVLRPTPIRAAEHAAPTYPTLATNALLRFH 189
            |...|..|  ..|| :||.   ||    |.:.| :|...|   |:..|..|..|   .::.|...
Mouse    19 PDLAPALSVVAAYP-LGLS---PGTAASPDLSYSQSYGHP---RSYSHPGPATP---GDSYLPRQ 73

  Fly   190 QHQKQQHQQHHHHQHHPKHLHQQHKPPPHNSTTASALLAPLHSLTSLQLTQQQQRFLGKTPQQLL 254
            |......|..|....||:.|..:           |..||       |.|...||:.|        
Mouse    74 QQLVAPSQPFHRPAEHPQELEAE-----------SEKLA-------LSLVPSQQQSL-------- 112

  Fly   255 DIAPTSPAAAAAATSQNGAHGHGGGNGQGNASAGSNGKRKRSWSRAVFSNLQRKGLEIQFQQQKY 319
                                                 .||....|.::|:||.:.|..:||..:|
Mouse   113 -------------------------------------TRKLRKPRTIYSSLQLQHLNQRFQHTQY 140

  Fly   320 ITKPDRRKLAARLNLTDAQVKVWFQNRRMKWRHTRENLKSGQEKQ------PSAVPESGGV-FKT 377
            :..|:|.:|||:|.||..|||:||||:|.|::...:. .||:.::      ||..|.|..: |..
Mouse   141 LALPERAQLAAQLGLTQTQVKIWFQNKRSKYKKLLKQ-SSGEPEEDFSGRPPSLSPHSPALPFIW 204

  Fly   378 STPSGDGTPQEALDYS 393
            ..|..|..|....|.|
Mouse   205 GLPKADTLPSSGYDNS 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 25/52 (48%)
Dlx4NP_031893.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 44..70 7/31 (23%)
Homeobox 119..172 CDD:278475 25/52 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 175..194 4/19 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.