DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and Dbx1

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001005232.1 Gene:Dbx1 / 13172 MGIID:94867 Length:335 Species:Mus musculus


Alignment Length:367 Identity:103/367 - (28%)
Similarity:142/367 - (38%) Gaps:134/367 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 LFPG---PYMDYKSVLRPTPIRAAEHAAPTYPTLATNALLRFHQHQKQQHQQHHHHQHHPKHLHQ 211
            :|||   |...|.|:|||||       ..|.|             |..|.....|.....:.|.:
Mouse     2 MFPGLLAPPAGYPSLLRPTP-------TLTLP-------------QSLQSAFSGHSSFLVEDLIR 46

  Fly   212 QHKPPPHNS-TTASALLAPLHSLTSLQLTQQQQRFL---------GKTPQ--------------- 251
            ..:||.:.| :..:|.|:|........|.......|         |.:||               
Mouse    47 ISRPPTYLSRSIPAASLSPPSQEAPAALADSGTSDLGSPGSGSRRGSSPQTALSPASEPTFLKFG 111

  Fly   252 --QLLDIAP---TSPAAAAAATSQNGAHGHGGGNGQ------------------GNAS--AGSNG 291
              .:|..||   ||||...:...:..|..:..|:.|                  |..|  ..:.|
Mouse   112 VNAILSSAPRRETSPALLQSPPPKTFAFPYFEGSFQPFIRSSYFPASSSVVPIPGTFSWPLAARG 176

  Fly   292 KRKRSW-SRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKWRHT-- 353
            |.:|.. .|||||::|||.||..||:||||:||||:|||::|.|.|:|||:||||||||||::  
Mouse   177 KPRRGMLRRAVFSDVQRKALEKTFQKQKYISKPDRKKLASKLGLKDSQVKIWFQNRRMKWRNSKE 241

  Fly   354 RENLKSG----------------------------QEKQPSA-----------------VPESGG 373
            ||.|.||                            :|..|.|                 :|.|  
Mouse   242 RELLSSGGCREQTLPTKLNPHPDLSDVGQKGPGDEEEDNPGARLAYHAPADPRHLLEGPLPAS-- 304

  Fly   374 VFKTSTPSGDGTPQEALDYSSDSCSSVDLSEQADEDDNIEIN 415
                  |:...:|.:..|: |||    |..|:.:||:.|.::
Mouse   305 ------PAHSSSPGKPSDF-SDS----DEDEEGEEDEEITVS 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 37/52 (71%)
Dbx1NP_001005232.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 58..102 8/43 (19%)
Homeobox 184..237 CDD:278475 37/52 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..335 21/107 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.