DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and AgaP_AGAP009646

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_318681.1 Gene:AgaP_AGAP009646 / 1279024 VectorBaseID:AGAP009646 Length:394 Species:Anopheles gambiae


Alignment Length:195 Identity:52/195 - (26%)
Similarity:78/195 - (40%) Gaps:51/195 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 HQHQKQQHQQHHHHQHHPKH---------------------LHQQHKPP-PHNSTTASALLAPLH 231
            |..|......||||.||..:                     ||....|| ..:.:..|:..||..
Mosquito   114 HLGQNPNLHHHHHHHHHGNNGGGNGGGGGSGGNAHDHLADGLHSIPSPPITVSGSDMSSPGAPTG 178

  Fly   232 SLTSLQLTQQQQRFLGKTPQQLLDIAPTSPAAAAAATSQNGAHGHGGGNGQGNASAGSNGK-RKR 295
            | :|.|:|.:....  |:|.:.:                         ..|...|..:.|| |.:
Mosquito   179 S-SSPQITPRPTPV--KSPYEWM-------------------------KKQSYQSQPNPGKTRTK 215

  Fly   296 SWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKWRHTRENLKSG 360
            ...|.|:::.||..||.:|...:|||...:.:||..|.|::.|||:||||||.|.|..::..::|
Mosquito   216 DKYRVVYTDQQRLELEKEFHYTRYITIRRKAELAQNLQLSERQVKIWFQNRRAKDRKQKKKAETG 280

  Fly   361  360
            Mosquito   281  280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 24/52 (46%)
AgaP_AGAP009646XP_318681.1 Homeobox 219..272 CDD:365835 24/52 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.