DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and AgaP_AGAP007985

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_317481.4 Gene:AgaP_AGAP007985 / 1277963 VectorBaseID:AGAP007985 Length:354 Species:Anopheles gambiae


Alignment Length:185 Identity:55/185 - (29%)
Similarity:82/185 - (44%) Gaps:30/185 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 SLTSLQLTQQQQRFLGKTPQ--QLLDIAP-------TSPAAAAAATSQNGAHGHGGGNGQGNAS- 286
            ::..|....|..|.:|.:.:  :|.||.|       .||...:|:|.|  ..|..||:.....| 
Mosquito     1 NIARLANLDQPSRPMGISDEGSRLEDIGPHEARPPQGSPLERSASTGQ--LMGSSGGDPNSPLSD 63

  Fly   287 --AGSNG-----KRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPD---RRKLAARLNLTDAQVKV 341
              :...|     |||:...|..|::.|.:.||..|.:..|   ||   |.:||.::.||:|:::|
Mosquito    64 PHSDDGGDDFAPKRKQRRYRTTFTSFQLEELEKAFSRTHY---PDVFTREELAMKIGLTEARIQV 125

  Fly   342 WFQNRRMKWRHTRENLKSGQEKQPSAVPESGGVFKTST---PSGDGTPQEALDYS 393
            ||||||.|||...:....|....|...  |.|...::|   ||....|...|.::
Mosquito   126 WFQNRRAKWRKQEKVGPQGHPYNPYLA--SAGQVPSATVVAPSLPPNPFSHLGFN 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 23/55 (42%)
AgaP_AGAP007985XP_317481.4 Homeobox 83..135 CDD:278475 23/54 (43%)
OAR 321..338 CDD:281777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.