powered by:
Protein Alignment H2.0 and AgaP_AGAP006540
DIOPT Version :9
Sequence 1: | NP_523488.2 |
Gene: | H2.0 / 33841 |
FlyBaseID: | FBgn0001170 |
Length: | 418 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_316578.4 |
Gene: | AgaP_AGAP006540 / 1277139 |
VectorBaseID: | AGAP006540 |
Length: | 334 |
Species: | Anopheles gambiae |
Alignment Length: | 75 |
Identity: | 21/75 - (28%) |
Similarity: | 32/75 - (42%) |
Gaps: | 4/75 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 277 GGGNGQGNASAG--SNGKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQV 339
|..:..|..:.| .|.|.|| .|..|:..|.:.|:..|.........|..::|:...|:....
Mosquito 145 GTSSDDGCEADGYQKNNKTKR--VRTTFTEEQLQILQANFNIDSNPDGQDLERIASVTGLSKRVT 207
Fly 340 KVWFQNRRMK 349
:|||||.|.:
Mosquito 208 QVWFQNSRAR 217
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.