DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment H2.0 and AgaP_AGAP006540

DIOPT Version :9

Sequence 1:	NP_523488.2	Gene:	H2.0 / 33841	FlyBaseID:	FBgn0001170	Length:	418	Species:	Drosophila melanogaster
Sequence 2:	XP_316578.4	Gene:	AgaP_AGAP006540 / 1277139	VectorBaseID:	AGAP006540	Length:	334	Species:	Anopheles gambiae

Alignment Length:	75	Identity:	21/75 - (28%)
Similarity:	32/75 - (42%)	Gaps:	4/75 - (5%)

- Green bases have known domain annotations that are detailed below.

  Fly   277 GGGNGQGNASAG--SNGKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQV 339
            |..:..|..:.|  .|.|.||  .|..|:..|.:.|:..|.........|..::|:...|:....
Mosquito   145 GTSSDDGCEADGYQKNNKTKR--VRTTFTEEQLQILQANFNIDSNPDGQDLERIASVTGLSKRVT 207

  Fly   340 KVWFQNRRMK 349
            :|||||.|.:
Mosquito   208 QVWFQNSRAR 217

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
H2.0	NP_523488.2	Homeobox	298..351	CDD:278475	14/52 (27%)
AgaP_AGAP006540	XP_316578.4	LIM1_AWH	23..76	CDD:188759
		LIM2_AWH	84..138	CDD:188765
		Homeobox	167..219	CDD:278475	14/51 (27%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910