Sequence 1: | NP_523488.2 | Gene: | H2.0 / 33841 | FlyBaseID: | FBgn0001170 | Length: | 418 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_313453.5 | Gene: | AgaP_AGAP003671 / 1274346 | VectorBaseID: | AGAP003671 | Length: | 485 | Species: | Anopheles gambiae |
Alignment Length: | 248 | Identity: | 66/248 - (26%) |
---|---|---|---|
Similarity: | 95/248 - (38%) | Gaps: | 97/248 - (39%) |
- Green bases have known domain annotations that are detailed below.
Fly 196 HQQHHHHQHHPKHL-HQQH------KPP-------------------------PHNSTTASAL-- 226
Fly 227 --LAPL---HSLTSLQLTQQQQRFLGK----------------TPQQ-----LLDIAPTSPAAAA 265
Fly 266 AAT---------------------SQN------------GAHG-HGGGNGQGNASAGSNGKRKRS 296
Fly 297 WSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMK 349 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
H2.0 | NP_523488.2 | Homeobox | 298..351 | CDD:278475 | 29/52 (56%) |
AgaP_AGAP003671 | XP_313453.5 | HOX | 238..294 | CDD:197696 | 30/56 (54%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D858478at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |