DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and AgaP_AGAP004659

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_311616.1 Gene:AgaP_AGAP004659 / 1272726 VectorBaseID:AGAP004659 Length:372 Species:Anopheles gambiae


Alignment Length:369 Identity:75/369 - (20%)
Similarity:121/369 - (32%) Gaps:139/369 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 VDRLLGSEPEESHRQSSSSPSTKSCCDGSILACCSFPHCFSQANAESRRFGHATLPPTFTPTSSH 140
            |:.:....|..| :.::|||:|..                ||.:.....|.    |.|:.|    
Mosquito    14 VNSIASCYPNNS-QNTNSSPNTAG----------------SQGSQNDGYFP----PSTYAP---- 53

  Fly   141 TYPFVGLDKLFPG-PYMDYKSVLRPTPIRAAEHAAPTYPTLATNALLRFHQ------HQKQQHQQ 198
                    .::|| |:..:.|.....|:..|  .|.:..:.:|.|:...||      :.:.|.| 
Mosquito    54 --------NIYPGTPHQAHYSPQSYNPLAGA--GATSVNSASTGAVGGGHQSTDMVDYTQLQPQ- 107

  Fly   199 HHHHQHHPKHLHQQHKPPPHNSTTASALLAPLHSLTSLQLTQQQQRFLGKTPQQLL--------- 254
                    |.|..|.:.|....|:.|...|.....|...:..........:||.|.         
Mosquito   108 --------KFLLSQQQQPQSALTSQSCKYASEGPSTGTNVINNNNNNSTTSPQDLSTASGGSSGA 164

  Fly   255 --------DIAPT-----------------SPAAAAAATSQN----------------------- 271
                    :|:|.                 :|:.|.:::|.|                       
Mosquito   165 NDGNNGRPEISPKLSPGSVVESVSRSLKSGNPSTAVSSSSTNNNTSNISNRNQVNLPLASPEEES 229

  Fly   272 ----------GAHGHGGGNGQ-------------------GNASAGSNGKRKRSWSRAVFSNLQR 307
                      |....|||...                   |.::..:||:.||  .|..::..|.
Mosquito   230 EASDDDSGTEGGSSQGGGGSSSKKGGPPPHIYPWMKRVHIGQSTVNANGETKR--QRTSYTRYQT 292

  Fly   308 KGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKWR 351
            ..||.:|...:|:|:..|.::|..|.||:.|:|:|||||||||:
Mosquito   293 LELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWK 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 22/52 (42%)
AgaP_AGAP004659XP_311616.1 Homeobox 284..336 CDD:278475 22/51 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.