DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and AgaP_AGAP004661

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_311623.2 Gene:AgaP_AGAP004661 / 1272724 VectorBaseID:AGAP004661 Length:327 Species:Anopheles gambiae


Alignment Length:153 Identity:46/153 - (30%)
Similarity:66/153 - (43%) Gaps:44/153 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   257 APTSPAAAAAA---------TSQNGAHGHGGGNG-------QGNAS------------------- 286
            :|.|.|.:|||         |:|....|..||..       |.|.:                   
Mosquito   160 SPVSRAGSAAAATGVPGSWNTNQCSLTGSTGGQAAPSTGLHQSNHTFYPWMAIAGKRYSESLAGT 224

  Fly   287 -----AGSNGKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNR 346
                 .|:||.|:|  .|..::..|...||.:|....|:|:..|.::|..|.||:.|:|:|||||
Mosquito   225 LLPDWIGANGLRRR--GRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNR 287

  Fly   347 RMKWRHTRENLK--SGQEKQPSA 367
            |||.:...:.:|  :.||||..|
Mosquito   288 RMKLKKEIQAIKELNEQEKQAQA 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 22/52 (42%)
AgaP_AGAP004661XP_311623.2 Homeobox 240..292 CDD:278475 22/51 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.