DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and ABDA_ANOGA

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_003436886.1 Gene:ABDA_ANOGA / 1272718 VectorBaseID:AGAP004662 Length:370 Species:Anopheles gambiae


Alignment Length:384 Identity:90/384 - (23%)
Similarity:132/384 - (34%) Gaps:128/384 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 VDHELPTKESCASTTIVSTSPTSATS--TTKVKLSFSVDRLLGSEPEESHRQSSSSPSTKSCCDG 103
            :..::.::....|.:.||.:|.|..|  ||            |||      .|.:||.|      
Mosquito    20 ISSQISSQSISNSNSTVSQTPNSEGSPLTT------------GSE------DSPNSPPT------ 60

  Fly   104 SILACCSFPHCFSQANAESRRFGHATLPPTFTPTSSHTYP-FVGL-DKLFPGPYMDYKSVLRPTP 166
                              |:.:...:..|| |.||..|.| |.|| ||.....|.|  ||:.   
Mosquito    61 ------------------SKMYPFVSNHPT-THTSYSTMPGFSGLDDKSCSSRYTD--SVMN--- 101

  Fly   167 IRAAEHAAPTYPTL---ATNALLRFHQHQKQQHQQHHHHQHHPKHLHQQHKPPPHNSTTASALLA 228
                     :||.:   .:.::.:|:|...                          :.:|::...
Mosquito   102 ---------SYPPMGVPGSASIAQFYQQAA--------------------------AVSAASAGV 131

  Fly   229 PLHSLTSLQLTQQQQRFLGKTPQQLLDIAPTSPAAAAAATSQNGAHGHGGGNGQGNA-------- 285
            .:.||.|  ...|....:|.....|.||. ..|....|  ||:........:...|.        
Mosquito   132 GVDSLGS--ACSQLSSSVGGAQSGLPDIT-RHPWLVTA--SQSALQKFASTDWMSNPFDRVVCGD 191

  Fly   286 SAGSNGKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKW 350
            .||.||..:|. .|..::..|...||.:|....|:|:..|.::|..|.||:.|:|:||||||||.
Mosquito   192 FAGPNGCPRRR-GRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKL 255

  Fly   351 RH----------------------TRENLKSGQE--KQPSAVPESGGVFKTSTPSGDGT 385
            :.                      ..|:|||.|:  .|..|..|...|....|.:|.||
Mosquito   256 KKELRAVKEINEQARREREEQDKMKNESLKSAQQHHSQKQAQQEHTVVGSQQTSNGGGT 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 22/52 (42%)
ABDA_ANOGAXP_003436886.1 Homeobox 204..256 CDD:278475 22/51 (43%)
Abdominal-A 258..280 CDD:289192 0/21 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.