DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and AgaP_AGAP000063

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_566364.4 Gene:AgaP_AGAP000063 / 1272212 VectorBaseID:AGAP000063 Length:564 Species:Anopheles gambiae


Alignment Length:195 Identity:54/195 - (27%)
Similarity:78/195 - (40%) Gaps:49/195 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 DIAPTS------PAAAAAATSQN-GAHGHGGGN-GQG----------NASAGSNGKRKRSWSRAV 301
            |:.|.|      |.|....|:.: |..|.|.|. |||          |.:...:.|||...:|..
Mosquito   223 DVKPMSDDGTKNPFAKHCFTNLDAGVPGAGTGTPGQGGPGTKQVFVDNDTERLSLKRKLQRNRTS 287

  Fly   302 FSNLQRKGLEIQFQQQKYITKPD---RRKLAARLNLTDAQ-----VKVWFQNRRMKWRHTRENLK 358
            |:..|.:.||.:|::..|   ||   |.:|:::.||.:|:     ::|||.|||.|||.      
Mosquito   288 FTVDQIEFLEKEFERTHY---PDVFSRERLSSKTNLPEARIQVSYIEVWFSNRRAKWRR------ 343

  Fly   359 SGQEKQPSAVPESGGVFKTSTPSGDGTPQEALDYSSDSCSSVDL------------SEQADEDDN 411
              :|||.|.....|.....:..:.......|:...:.|.||..|            |....||.|
Mosquito   344 --EEKQRSQAVSEGSSSAAAAAAAAAAAAAAVAVQNASISSCSLNLTAPLVSHVYDSNMCVEDSN 406

  Fly   412  411
            Mosquito   407  406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 21/60 (35%)
AgaP_AGAP000063XP_566364.4 PAX 7..131 CDD:128645
Homeobox 285..342 CDD:278475 21/59 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.