DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and AgaP_AGAP000190

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_310944.5 Gene:AgaP_AGAP000190 / 1272074 VectorBaseID:AGAP000190 Length:493 Species:Anopheles gambiae


Alignment Length:217 Identity:63/217 - (29%)
Similarity:89/217 - (41%) Gaps:60/217 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 HHHHQHHPKHLHQQHKPPPHNSTTASALLAPLHSLTSLQLTQ--QQQRFLGKTPQQLLDIAPTS- 260
            ||||.||    |.||    |:|   |||..||..|.....|.  ::....|.|....:|.|... 
Mosquito   128 HHHHHHH----HHQH----HHS---SALHEPLEKLKLWAETGDFRENSHTGMTSVSSIDHAQMGF 181

  Fly   261 PAAA-------------------AAATSQNGAHGHGGGNGQGNASAGS--------------NGK 292
            ||::                   |:..::|.:.|....:|.|:.:.|:              ..|
Mosquito   182 PASSPRNRSSRDRKNDVSRCINEASVKTENLSSGMSHEDGTGSVAPGTTIQQDGTDGTKNDKKNK 246

  Fly   293 RKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKWRHTREN- 356
            |:|. .|..|::.|...||..|.:.:|.....|.::|...|||:|:|:|||:|||.|||....| 
Mosquito   247 RQRR-QRTHFTSQQLHELEQTFSRNRYPDMSTREEIAMWTNLTEARVRVWFKNRRAKWRKRERNQ 310

  Fly   357 --------LKSG---QEKQPSA 367
                    .|:|   |..||.|
Mosquito   311 MNAIAAADFKNGFGPQFVQPFA 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 21/52 (40%)
AgaP_AGAP000190XP_310944.5 Homeobox 252..304 CDD:278475 21/51 (41%)
OAR 445..460 CDD:281777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.