Sequence 1: | NP_523488.2 | Gene: | H2.0 / 33841 | FlyBaseID: | FBgn0001170 | Length: | 418 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_310944.5 | Gene: | AgaP_AGAP000190 / 1272074 | VectorBaseID: | AGAP000190 | Length: | 493 | Species: | Anopheles gambiae |
Alignment Length: | 217 | Identity: | 63/217 - (29%) |
---|---|---|---|
Similarity: | 89/217 - (41%) | Gaps: | 60/217 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 199 HHHHQHHPKHLHQQHKPPPHNSTTASALLAPLHSLTSLQLTQ--QQQRFLGKTPQQLLDIAPTS- 260
Fly 261 PAAA-------------------AAATSQNGAHGHGGGNGQGNASAGS--------------NGK 292
Fly 293 RKRSWSRAVFSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKWRHTREN- 356
Fly 357 --------LKSG---QEKQPSA 367 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
H2.0 | NP_523488.2 | Homeobox | 298..351 | CDD:278475 | 21/52 (40%) |
AgaP_AGAP000190 | XP_310944.5 | Homeobox | 252..304 | CDD:278475 | 21/51 (41%) |
OAR | 445..460 | CDD:281777 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |