DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and AgaP_AGAP000215

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_310918.5 Gene:AgaP_AGAP000215 / 1272051 VectorBaseID:AGAP000215 Length:458 Species:Anopheles gambiae


Alignment Length:205 Identity:50/205 - (24%)
Similarity:72/205 - (35%) Gaps:69/205 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 HQQHHHHQHHPKHLHQQHKPPPHNSTTASALLAPLHSLTSLQLTQQQQRFLGKTPQQLLDIAPTS 260
            |...:...|||.|.|.....||....|:.|.....|.|.::..           ||.:..:.|  
Mosquito    28 HPHGYGSAHHPHHAHPHGPLPPGMPMTSLAPFGLPHGLDAVGF-----------PQGMWGVNP-- 79

  Fly   261 PAAAAAATSQNGAHGHGGGNGQGNASAGSNGKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKPD- 324
                                            ||:...|..|:..|...||..|.:.:|   || 
Mosquito    80 --------------------------------RKQRRERTTFTRAQLDVLEALFGKTRY---PDI 109

  Fly   325 --RRKLAARLNLTDAQV-----KVWFQNRRMKWR-----HTRENLKS-----GQEKQPSAVPESG 372
              |.::|.::||.:::|     :|||:|||.|.|     .:..||.|     |.....:...:||
Mosquito   110 FMREEVALKINLPESRVQVSVGEVWFKNRRAKCRQQLQHQSSSNLNSSKSSGGGSTGSARSGQSG 174

  Fly   373 GVFKTSTPSG 382
            |   .|.|||
Mosquito   175 G---NSGPSG 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 21/60 (35%)
AgaP_AGAP000215XP_310918.5 Homeobox 86..143 CDD:278475 21/59 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.