DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and AgaP_AGAP011134

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_309513.3 Gene:AgaP_AGAP011134 / 1270792 VectorBaseID:AGAP011134 Length:501 Species:Anopheles gambiae


Alignment Length:211 Identity:51/211 - (24%)
Similarity:64/211 - (30%) Gaps:67/211 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 LGKTPQQLLDIAPTS------------PAAAAAATSQN-GAHG--HGGG---------------- 279
            |||.|..:.|....|            |...|...|.. ||.|  ||.|                
Mosquito   143 LGKGPHPMTDSLMGSASEDEDEEDQMRPGVLAGLVSGGAGAAGLHHGDGPLGASDLSVQSMSTDS 207

  Fly   280 ------NGQG---------------NASAGSNGKRKRSWSRAVFSNLQRKGLEIQFQQQKYITKP 323
                  :.||               |.|.......||...|......|.:.|:..|.|....|:.
Mosquito   208 KTGHDDSDQGSLDGDPDCRGDSQAENKSPDDGAGSKRRGPRTTIKAKQLEVLKNAFSQTPKPTRH 272

  Fly   324 DRRKLAARLNLTDAQVKVWFQNRRMKWRHTRENLKSGQEKQPSAVPESGGVFK------TSTPSG 382
            .|.:||....|....::|||||:|.|.|..::....|:.      |..||..|      ..:|.|
Mosquito   273 IREQLAKETGLPMRVIQVWFQNKRSKERRLKQLTSMGRG------PFFGGARKMRGFPMNLSPGG 331

  Fly   383 ---DGTPQEALDYSSD 395
               .|.|..|.|...|
Mosquito   332 LDEPGFPYFAADGKFD 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 17/52 (33%)
AgaP_AGAP011134XP_309513.3 LIM1_Lhx1_Lhx5 27..78 CDD:188753
LIM2_Lhx1_Lhx5 86..141 CDD:188761
Homeobox 247..300 CDD:278475 17/52 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.