DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and AgaP_AGAP007058

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_308706.3 Gene:AgaP_AGAP007058 / 1270045 VectorBaseID:AGAP007058 Length:302 Species:Anopheles gambiae


Alignment Length:228 Identity:59/228 - (25%)
Similarity:88/228 - (38%) Gaps:76/228 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 TPQQLLDIAPTSPAAAAAATSQNGAHGHGG-------GNGQGNASAG------------------ 288
            || :.:|...|:.|...:|..:...||:||       .:.||...:|                  
Mosquito     9 TP-KYIDGGATATAPGKSAFVELQQHGYGGIRSGYQHFSAQGGQDSGFPSPRGALGYPFPPMHQN 72

  Fly   289 -------------------------------SNGK-RKRSWSRAVFSNLQRKGLEIQFQQQKYIT 321
                                           .||| :|....|.::|:||.:.|..:||:.:|:.
Mosquito    73 SYSGYHLGSYAPPCASPPKDGKYKLEDTGLRVNGKGKKMRKPRTIYSSLQLQQLNRRFQRTQYLA 137

  Fly   322 KPDRRKLAARLNLTDAQVKVWFQNRRMKWRHTRENLKSGQEK-----QPSAVPESGGVFKT---- 377
            .|:|.:|||.|.||..|||:||||||.|:   ::.:|:.|..     .|...|..||...:    
Mosquito   138 LPERAELAASLGLTQTQVKIWFQNRRSKY---KKMMKAAQAPGVGGGLPLGGPNQGGHSPSQHQN 199

  Fly   378 --STPSG---DGTPQEALDYS-SDSCSSVDLSE 404
              ..|.|   .|:|...|... |.:.||..:||
Mosquito   200 MHQAPGGGSSSGSPSHFLPPGHSPTPSSTPVSE 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 26/52 (50%)
AgaP_AGAP007058XP_308706.3 Homeobox 114..167 CDD:278475 26/55 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.