DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2.0 and Barx1

DIOPT Version :9

Sequence 1:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_031552.2 Gene:Barx1 / 12022 MGIID:103124 Length:254 Species:Mus musculus


Alignment Length:303 Identity:81/303 - (26%)
Similarity:112/303 - (36%) Gaps:97/303 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 RFGHATLPPT-FTPTSSHTYPFVGLDKLF---PGPYMDYKSVLRPTPIRAAEHAAPTYPTLATNA 184
            |||    ||. ......|.|....::::.   |||                :.|||.....|...
Mouse    11 RFG----PPEGCADHRPHRYRSFMIEEILTEPPGP----------------KGAAPAAAAAAAGE 55

  Fly   185 LLRFHQHQKQQHQQHHHHQHHPKHLHQQHKPPPHNSTTASALLA--PLHSLTSLQLTQQQQRFLG 247
            ||:|                                 ...||||  |.||  .|.:.:.:|..:.
Mouse    56 LLKF---------------------------------GVQALLAARPFHS--HLAVLKAEQAAVF 85

  Fly   248 KTPQQLLDIAPTSPAAAAAATSQNGAHG----------HGGGNGQGNASAGSNGKRKRSWSRAVF 302
            |.|...|..:....|..||.....|..|          .|.....|:...|:..|:.|. ||.||
Mouse    86 KFPLAPLGCSGLGSALLAAGPGMPGPAGASHLPLELQLRGKLEAAGSGEPGAKAKKGRR-SRTVF 149

  Fly   303 SNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKWRHTRENLKSGQEKQPSA 367
            :.||..|||.:|::|||::.|||..||..|.|:..|||.|:|||||||:              ..
Mouse   150 TELQLMGLEKRFEKQKYLSTPDRIDLAESLGLSQLQVKTWYQNRRMKWK--------------KI 200

  Fly   368 VPESGGVFKTSTPSGDGTPQEALDYSSDSCSSVDLSEQADEDD 410
            |.:.||:...:.|.  |.|::         :|:..|||..|.:
Mouse   201 VLQGGGLESPTKPK--GRPKK---------NSIPTSEQLTEQE 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 30/52 (58%)
Barx1NP_031552.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20 5/12 (42%)
Homeobox 145..198 CDD:278475 30/52 (58%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..254 10/40 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.